SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|428310567|ref|YP_007121544.1| from Microcoleus sp. PCC 7113

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|428310567|ref|YP_007121544.1|
Domain Number 1 Region: 1-189
Classification Level Classification E-value
Superfamily Restriction endonuclease-like 4.02e-21
Family Hypothetical protein TT1808 (TTHA1514) 0.056
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|428310567|ref|YP_007121544.1|
Sequence length 192
Comment hypothetical protein Mic7113_2333 [Microcoleus sp. PCC 7113]
Sequence
MTQVTTKRFTLAEYHRLIELGFLTEDDRVELIRGELVQMAAKGTLHSVCNTKLARELDRL
VENLAVIRGQEPIILPTNSEPEPDVVIVRGQPDDYLLNHPYPKDVLLLIEVSDSTLVYDQ
TVKLSLYAEAQIQNYWIMNLVANQVERYTQPYQDSQGNFGYRIRQIALRNEIVTIPGFSD
LLLDLNLVFPGL
Download sequence
Identical sequences K9WD49
WP_015182288.1.75295 gi|428310567|ref|YP_007121544.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]