SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|428310727|ref|YP_007121704.1| from Microcoleus sp. PCC 7113

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|428310727|ref|YP_007121704.1|
Domain Number 1 Region: 2-231,352-399
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.05e-81
Family Tandem AAA-ATPase domain 0.000000102
Further Details:      
 
Domain Number 2 Region: 711-928
Classification Level Classification E-value
Superfamily Helical scaffold and wing domains of SecA 2.22e-70
Family Helical scaffold and wing domains of SecA 0.00000982
Further Details:      
 
Domain Number 3 Region: 401-509,609-709
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.5e-52
Family Tandem AAA-ATPase domain 0.00000725
Further Details:      
 
Domain Number 4 Region: 230-352
Classification Level Classification E-value
Superfamily Pre-protein crosslinking domain of SecA 1.01e-45
Family Pre-protein crosslinking domain of SecA 0.0000366
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|428310727|ref|YP_007121704.1|
Sequence length 930
Comment protein translocase subunit secA [Microcoleus sp. PCC 7113]
Sequence
MLKTVLGDPNARKLKKYQPYVVDVNVLEDEIQALSDDQLKGKTAEFQQKLAKARSDRERA
EVLDELLPEAFAVVREAGRRVLGMRHFDVQLLGGIVLHKGQIAEMKTGEGKTLVSTLPAY
LNALSGKGVHVVTVNDYLARRDAEWMGQVHRYLGLSVGLIQSGMGPAERQRNYACDITYA
TNSELGFDYLRDNMATVMSDVVQRPFNYCVIDEVDSVLIDEARTPLIISGQVERPTEKYL
KAAQIARALQKEEHYEVDEKARNVLLTDEGFAEAEKLLEVEDLYNPEDPWAHYIFNAIKA
KELFLADVNYIVRNGEVVIVDEFTGRVLSGRRWSDGLHQAIEAKENVDIQNETQTLATIT
YQNFFLLYPKLAGMTGTAKTEESEFEKIYNLQVTIIPTNRPSGRHDLSDVVYKTEPAKWQ
AIAEECAQMHEEGRPVLVGTTSVEKSELLSGLLKQRAVPHELLNARPENVERESEIVAQA
GRKGAVTIATNMAGRGTDIILGGNSDYMARLKLREYFMPKIVMPEQEDALTPVSVPGASE
RARPQGFAPGKKVKTWKASPQIFPTELSKETEQLLKDAVNFAVKRYGERSLPELEADEKI
AVAAEKAPTDDPVIEKLREVYKAIRKEYEHLTSREHDEVVKLGGLHVIGTERHESRRIDN
QLRGRAGRQGDPGSTKFFLSLEDNLLRIFGGDRVAGLMNAFRVEEDMPIESKMLTRSLEG
AQKKVETFYYDTRKQVFEYDEVMNNQRRAIYAERRRVLEGLDLKEQVIQYAERTMDDIVE
AYVNPDLPQEEWQLDQLVSKVKEFVYLLQDLEPQHLEDMSVAEIKTFMHEEVRKAYDIKE
SQVDQIQPGLMRQAERFFILQQIDTLWREHLQSMDALRESVGLRGYGQKDPLIEYKQEGY
ETFLEMMIDIRRNVVYSLFQFQPQAQPQAV
Download sequence
Identical sequences K9WDI7
WP_015182447.1.75295 gi|428310727|ref|YP_007121704.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]