SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|428310946|ref|YP_007121923.1| from Microcoleus sp. PCC 7113

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|428310946|ref|YP_007121923.1|
Domain Number - Region: 6-33
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.0157
Family LIM domain 0.04
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|428310946|ref|YP_007121923.1|
Sequence length 60
Comment hypothetical protein Mic7113_2733 [Microcoleus sp. PCC 7113]
Sequence
MLVNTCPCCGSVLLRHARRKGVYWYCTSCHEEMVPLMMGQLPMCSEPRKKRSQILQSVNS
Download sequence
Identical sequences K9WG72
gi|428310946|ref|YP_007121923.1| WP_015182666.1.75295

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]