SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|428310959|ref|YP_007121936.1| from Microcoleus sp. PCC 7113

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|428310959|ref|YP_007121936.1|
Domain Number 1 Region: 452-558
Classification Level Classification E-value
Superfamily PKD domain 0.000000167
Family PKD domain 0.0068
Further Details:      
 
Weak hits

Sequence:  gi|428310959|ref|YP_007121936.1|
Domain Number - Region: 205-299
Classification Level Classification E-value
Superfamily PKD domain 0.0902
Family PKD domain 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|428310959|ref|YP_007121936.1|
Sequence length 603
Comment PEP-CTERM motif protein [Microcoleus sp. PCC 7113]
Sequence
MHSSCLKKQSTRLVGTMFILLGSAAASQATTLTGYATYGNMMSGMRVTANFLDGSSQTLT
WGATDAISGGVFSNTWSLTQSGNTYAPDNSNPEAAAWILTNYGAGITSLVIDAIPGNTVF
DNVYEVNTPLQTPGSERGWPFQVVSGLGPSSFNFSTPIDISYGDLFGKLSLYWNTGFTGI
LRFFADADSGTSSDPVRPRDPVEYNSPPTVYFAAPTIYEGQSASTVVQATDPGAEAITFL
LNGGNIGTDYTQAGVRQVGVNFGTFLDNGNYTYTAQARDEGGNYSLPVTSTLSVLNLPPT
ITGVNIPTIYEGQSALAYISATDPGADAVNFYLNGNYVGTDFNTSGTRAVSTNLGYFADN
GYIPYTASALDKDGAWSEPVASGLSVLNVAPTLTSFDLAEYVINEGQSVTALLTATDPGA
DAQTFFINGVNIGTDLQISGTRAATTNLGSFATGTYTFTGLAQDKDGAWSNPIERTLIVS
NVAPTITQVTQNLVAKANDFFDFAVSAVDPGKDSTVLTYEWDLNGDGLFDDFVGAAGQWT
FPDYGNYKVAVRVSDGDGGYAYGSFDVESVPEPSSALGVFLFSAGGAAALWKRKQPPKSN
NQG
Download sequence
Identical sequences K9WDR1
WP_015182679.1.75295 gi|428310959|ref|YP_007121936.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]