SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|428311327|ref|YP_007122304.1| from Microcoleus sp. PCC 7113

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|428311327|ref|YP_007122304.1|
Domain Number 1 Region: 139-478,507-582
Classification Level Classification E-value
Superfamily (Trans)glycosidases 3.07e-130
Family Amylase, catalytic domain 0.000000142
Further Details:      
 
Domain Number 2 Region: 8-152
Classification Level Classification E-value
Superfamily E set domains 1.52e-51
Family E-set domains of sugar-utilizing enzymes 0.0016
Further Details:      
 
Domain Number 3 Region: 596-706
Classification Level Classification E-value
Superfamily Glycosyl hydrolase domain 2.52e-25
Family alpha-Amylases, C-terminal beta-sheet domain 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|428311327|ref|YP_007122304.1|
Sequence length 709
Comment isoamylase [Microcoleus sp. PCC 7113]
Sequence
MYIATLWPGKVYPLGATWDGKGTNFALFSENATGVELCLFDKDDEETRLELTEVSNFVWH
GYVPGVGPGQRYGYRVHGPYDPQNGHRFNPNKLLIDPYAKAIDGDIGNGPELFGYSWEAA
EEDLSFSDLDSAHLMPKCVVVDQSFDWGDDQLLKTPWHETVIYETHVKGFTKLHPDIPEE
LQGTYAGLAHPAAIEHLQAIGITAVELLPVHHFLARPGHLVDKGLSNYWGYDSINYLAPY
SGYSADKVPGGQVKEFKEMVKALHFAGIEVILDVVYNHTGEGNHMGPTLSLRGIDNAIYY
RLVEDDPRYYMDFTGCGNSLNVRQAQVLKLIMDSLRYWVTEMHVDGFRFDLASALARELF
AVDNLSAFFDIIHQDPVLADVKLIAEPWDVGEGGYQVGNFPVLWSEWNGRYRDTVRDFWR
GEESGLGQFAYCFTGSPDLYEINGRRPNASINFLTAHDGFTLNDLVSYNEKHNEGNGENN
CDGESHNRSWNCGAEGETDDPGVLQLREQQRRNMLATLMLSQGIPMLLGGDEMGRTQRGN
NNGYCQDNELSWFDWNLPEGNADLLKFTSQLIYFRRQHRVFHRRKWFQGRAIHGSGITDI
AWFNADGGEMTDEQWEVGYAKTLAVFLNGQEIPARGPKGERIIDDDFLLFFNAHYETVEF
TLPEGLRDKQWAVVIDTKEPRFLNEEQVFTDTQAVPVTARSLVVLRRVS
Download sequence
Identical sequences K9WF99
WP_015183043.1.75295 gi|428311327|ref|YP_007122304.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]