SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|428311380|ref|YP_007122357.1| from Microcoleus sp. PCC 7113

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|428311380|ref|YP_007122357.1|
Domain Number 1 Region: 8-432
Classification Level Classification E-value
Superfamily Clc chloride channel 1.23e-104
Family Clc chloride channel 0.00000136
Further Details:      
 
Domain Number 2 Region: 444-573
Classification Level Classification E-value
Superfamily CBS-domain pair 5.05e-34
Family CBS-domain pair 0.00078
Further Details:      
 
Domain Number 3 Region: 597-729
Classification Level Classification E-value
Superfamily Adenine nucleotide alpha hydrolases-like 0.0000000000000181
Family Universal stress protein-like 0.019
Further Details:      
 
Domain Number 4 Region: 752-878
Classification Level Classification E-value
Superfamily Adenine nucleotide alpha hydrolases-like 0.000000000977
Family Universal stress protein-like 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|428311380|ref|YP_007122357.1|
Sequence length 883
Comment chloride channel protein EriC [Microcoleus sp. PCC 7113]
Sequence
MTTSPVFLSARLRQWLLPRRRLAIAEACLIGIVSGLSAVLLKQGAGWLGTWRVHASNQLP
ASLVLPAIGLSLGLLCGLIIERLEPEATGSGVPQIKGALALFPIALNLRVAFVKLVTSIL
AMSAGMTLGRQGPTVHIGAALAAQLSHWVPTSPDHRRQMIAAGAAAGLAAGFNAPLAGIL
FVIEELLRDLSNLTLGTAILASFIGAVISRSLGGLTLDLNLQLSSHSSSFSAPEIPFYLL
LGILAGLLGALFNQGILASLSLYNRLNLNLPMKIGLAGMICGCVVALLPPAFRDNSGLRE
LLLTGTASWQFTSFAFVAYFVLTLIAYGSGAPGGLFHPSLVLGAALGYLVGTAEVQLLGL
GSPTSYALAGMGAFFSAVSKVPITAIVIVFEMTTNFNLVLPLMITSGVSYLIADKLSKGS
LYQRLLNKRGYTLPTQGVEQSSLAGLTAADLMQRRVETLASQMTLDEAVQAFSRSHHRGF
PVVDDGELVGIITQTDIANATQNSQPGDTPLAQIMTPQPITVKPIYTLSEVLFLLNRYQL
SRLPVTEDRKLVGIITRADIIRAEADKLSGDTEQVGPRPDPSYIVYQTRAPAVGKGRLLV
TLANPQTAPVLLQLAAAIARERHYEIECLQVISIPRHHNPTQTAVITTKSRRLLRMAEKM
GRDWEVPVHTQIRVSHDTSQAILETIKERHISLILMGWKAEPPTTPNRIFGSIVDTLIRQ
APCELVLVKLGHREEMQRDGTTVASCPLPIAWNRWLVPIAGGPNASCAIQLLPALTSHNS
ALMIGVTQVFAPSILLPDTSGLEKAAFLLSHQVSCQKVVTIPVRSYSVSDALIRLAHTQH
YDVVVLGASREGLLQQVVHGNIPEAIARGVNSTVILVRGAPSE
Download sequence
Identical sequences K9WGL4
WP_015183095.1.75295 gi|428311380|ref|YP_007122357.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]