SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|428311504|ref|YP_007122481.1| from Microcoleus sp. PCC 7113

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|428311504|ref|YP_007122481.1|
Domain Number 1 Region: 623-1003
Classification Level Classification E-value
Superfamily Quinoprotein alcohol dehydrogenase-like 6.04e-95
Family Quinoprotein alcohol dehydrogenase-like 0.019
Further Details:      
 
Domain Number 2 Region: 967-1220
Classification Level Classification E-value
Superfamily WD40 repeat-like 5.86e-91
Family WD40-repeat 0.00000657
Further Details:      
 
Domain Number 3 Region: 120-397
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 2.25e-34
Family Extended AAA-ATPase domain 0.05
Further Details:      
 
Domain Number 4 Region: 561-600
Classification Level Classification E-value
Superfamily Pentapeptide repeat-like 0.0000128
Family Pentapeptide repeats 0.021
Further Details:      
 
Weak hits

Sequence:  gi|428311504|ref|YP_007122481.1|
Domain Number - Region: 6-67
Classification Level Classification E-value
Superfamily Sigma3 and sigma4 domains of RNA polymerase sigma factors 0.0085
Family Sigma4 domain 0.069
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|428311504|ref|YP_007122481.1|
Sequence length 1323
Comment WD40 repeat-containing protein [Microcoleus sp. PCC 7113]
Sequence
MNPEEALTIVEQALSENRLSKLQVTVFRHAWEEQSYQAIAKTSGYELGYVKQTGSQLWQL
LSKAFGEKVTKSNLQLVLQRKAKEKSQELGVVEASHDSLLQELRITKNQHHLIQNPKSKI
QNRRDWGDAPDSSLFYGRNEELVTLERWIVQDGCRLIGLFGMGGIGKTSLSVNLAKQIQD
EFECVIWRSLRNAPPLQELLADLIQFLAIQQNATLPDTLNGRILKLLDCLRQHRCLVVFD
NVETIMQPGDRIGSYLVGYENYGQLLKCLGETDHQSTIMLTSREKPKEIAAIEGNSLPIR
SMRLTGLCKSAVQNIFSVKGDFAGSAEEWRVLVEHYAGNPLALKMVACAIKDFFEGSLAN
FLECLQQGTLVFGDVRDLLAHQIDRLSDLEQQVMYWLAINREPVTLSELRTDFVPQVSLA
DLLEALTSLERRCLLDKATPTLIEQNRTLFTLQPVVMEYMTDRLIARVCSELSRSVGAMN
ESGFRLFKTHALLKAQTKDYIRETQIRLILKPVAETLLHANSKEQLENHLRKIISKLRGK
SSQGTGYIGGNILNLLCQLSSDLSGWDFSDLTVWQAYLERVNLHQVNFAHANLAKSVFTD
TLSQILSVAFSPDGQLLATGDVNHEIHVWQVETGKQLLTCKIDEGWIWSVAFSPDGRFLA
SSANRIVNLWDVQTGECIKQFQGYSDRIFSLAFSPDGRLLATGSEDRCVRVWDVRTGQLF
KILSGHTNEVRSVAFAPQYSARRTQKNSGFREHLLPINPTPLSSEYLLASGSYDGTVRLW
DINQGECLSILEEHTDRVWSVAFSPDGKILASSSSDRTVKLWEASSGKCLKSLWGHTQQI
RTVAFSPDGKTLASGSDDHCVRLWNQHTGECLRILQGHTSWISSIAFSPVSKAVATLGAS
DSLLASGSEDQSVRVWETRTNLCLKTIQGHSNGVWSVAFNSQGTTLASGSQDGVIRFWHS
KTGKSIREFPAHSSWIWSVTFSPNRHILASGSEDRTIKLWDILGEQHLKTLTGHKDAVFS
LLFSPNGQTLFSGSLDGTIKLWDILTGECRQTWQGHSGGIWSISLSSDGKLLASGSQDQT
LKLWDVDTGCCIKTLPGHRSWIRACAISPNQQILVSGSADGTIKLWRINTGECYQTLQAH
AGPVLSVAFDPDEQTFASSGADGFVKLWNISSLPSCQILHGHDKWVRFLAYSPDGQILAS
CSQDETIKLWQVKPDGFPISLSHSSTLVRSREYDTTWMSTSISSGKTTLGMTPTGGEYQL
GLTPGKGTINRRQTQNSQGGFSARIKTLRIPRPYEGMNITDIKGLTAAQKSTLKMLGAVD
DRS
Download sequence
Identical sequences K9WFC2
gi|428311504|ref|YP_007122481.1| WP_015183218.1.75295

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]