SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|428311748|ref|YP_007122725.1| from Microcoleus sp. PCC 7113

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|428311748|ref|YP_007122725.1|
Domain Number 1 Region: 141-360
Classification Level Classification E-value
Superfamily Nitrite and sulphite reductase 4Fe-4S domain-like 6.28e-54
Family Nitrite and sulphite reductase 4Fe-4S domain-like 0.00000529
Further Details:      
 
Domain Number 2 Region: 445-593
Classification Level Classification E-value
Superfamily Nitrite and sulphite reductase 4Fe-4S domain-like 9.95e-37
Family Nitrite and sulphite reductase 4Fe-4S domain-like 0.0000573
Further Details:      
 
Domain Number 3 Region: 11-140
Classification Level Classification E-value
Superfamily Nitrite/Sulfite reductase N-terminal domain-like 3.76e-29
Family Duplicated SiR/NiR-like domains 1 and 3 0.0034
Further Details:      
 
Domain Number 4 Region: 361-435
Classification Level Classification E-value
Superfamily Nitrite/Sulfite reductase N-terminal domain-like 9.32e-19
Family Duplicated SiR/NiR-like domains 1 and 3 0.0038
Further Details:      
 
Weak hits

Sequence:  gi|428311748|ref|YP_007122725.1|
Domain Number - Region: 613-655
Classification Level Classification E-value
Superfamily Ribbon-helix-helix 0.000191
Family Omega transcriptional repressor 0.057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|428311748|ref|YP_007122725.1|
Sequence length 657
Comment sulfite reductase (ferredoxin) [Microcoleus sp. PCC 7113]
Sequence
MVNSPTSPSVQKRSKNEALKERSNYLREPVATELLQDTTRFTEDAIQILKFHGSYQQDNR
DNRAKGQEKDYQFMLRTRSPGGFIPPELYLTLDRLSQEYGNHTLRATTRQGFQIHGILKK
NLKTVFASIIRSMGSTLGACGDLNRNIMAPPAPYKNRPEYQYAWEYANHIADLLTPQTGA
YYELWLDGEKVISAEEAPEVKAARERNLNGTNLPDPEEPIYGQHYMPRKFKIAVTVPGDN
SIDLYTQDVSLVVITNKKGKLEGFNVLAGGGLGRTHNKEDTFVRMADAIGYVSKEDVYDL
VKAIVATQRDYGDRANRRHARMKYLLQDWGVEKFTAKVEEYFGKKIAPYKPLPAFKYQDY
LGWNEQGDGKLFLGISVENGRVKDEGTFRLKSALREIVQQYSLPMRLTGNHNIILYDIEP
SQQLAIEQLLEQHGIQISPEGIEPLVRYSMACPALPTCGLAITESERAIPGILERIRALL
DKVGLENEHFVVRMTGCPNGCARPYMAELGFVGSAPESYQVWLGGSPDQTRLAQAYVDRM
PIHELELFLEPIFVFFKKERKAGEKFGDFCDRVGFDAIRQYTVEYESPKLNSQSDTGLVN
EVIKPEPSAIPVASGKTRYRVGVRDELYKRLKNVATKQGKTMTELAAEALEAYLKDI
Download sequence
Identical sequences K9WHR3
gi|428311748|ref|YP_007122725.1| WP_015183461.1.75295

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]