SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|428311784|ref|YP_007122761.1| from Microcoleus sp. PCC 7113

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|428311784|ref|YP_007122761.1|
Domain Number 1 Region: 358-543
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 3.61e-65
Family Pyruvate oxidase and decarboxylase PP module 0.0000533
Further Details:      
 
Domain Number 2 Region: 2-169
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 4.26e-55
Family Pyruvate oxidase and decarboxylase Pyr module 0.0000202
Further Details:      
 
Domain Number 3 Region: 182-363
Classification Level Classification E-value
Superfamily DHS-like NAD/FAD-binding domain 1.43e-42
Family Pyruvate oxidase and decarboxylase, middle domain 0.0011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|428311784|ref|YP_007122761.1|
Sequence length 548
Comment thiamine pyrophosphate-dependent protein [Microcoleus sp. PCC 7113]
Sequence
MGEINTAELLVRCLENEGVEYVFGLPGEENLHVLEALRHSSIKFITTRHEQGAAFMADLY
GRLTGKAGVCLSTLGPGATNLMTGVADANLDGAPLVAITGQVGTDRMHIESHQYLDLVAM
FAPVTKWNAQIVRPSNTAEIVRKAFKIAQSEKPGAVHIDLPENIAAMPVLGQPLAKDERE
KTYASFRSIGKAAVAISKAKNPLILVGNGAIRAGASEALTEFATRMNIPVVNSFMGKGVI
PYTHPLALWTVGLQQRDHVSCAFDQADLIIAVGYDLVEYSPKKWNPEGKIPIIHIGMSPA
EIDSSYIPLVEVVGDISDSLAEIMKQADREGKTIPYAVELRADIRADYELYANDEGFPIK
PQKLIYDLRQVMGPDDIVISDVGAHKMWMARQYHCDRPNTCIISNGFAAMGIALPGAIGA
KLVYPERNVVAVTGDGGFMMNCQELETALRVGTPFVTLIFNDGGYGLIEWKQQNHFGDSA
FIRFGNPDFVKFAESMGLKGYRVNSAAELIPTLKEALAQDVPTVIDCPVDYGENLRFTQK
AGDLSCKI
Download sequence
Identical sequences K9WG09
WP_015183496.1.75295 gi|428311784|ref|YP_007122761.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]