SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|428311890|ref|YP_007122867.1| from Microcoleus sp. PCC 7113

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|428311890|ref|YP_007122867.1|
Domain Number 1 Region: 88-514
Classification Level Classification E-value
Superfamily (Trans)glycosidases 2.54e-110
Family Amylase, catalytic domain 0.00000000439
Further Details:      
 
Domain Number 2 Region: 3-92
Classification Level Classification E-value
Superfamily E set domains 0.0000000000000044
Family E-set domains of sugar-utilizing enzymes 0.001
Further Details:      
 
Weak hits

Sequence:  gi|428311890|ref|YP_007122867.1|
Domain Number - Region: 532-590
Classification Level Classification E-value
Superfamily Glycosyl hydrolase domain 0.000168
Family alpha-Amylases, C-terminal beta-sheet domain 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|428311890|ref|YP_007122867.1|
Sequence length 610
Comment maltooligosyl trehalose hydrolase [Microcoleus sp. PCC 7113]
Sequence
MKIGADYLGDGRCEFTVWAPAHEEVAVQIVSPVQRLLPMQKDEWGYFKVLAENIEPGTLY
CYKLGAEADRPDPASHSQPKDVHGPSSVVDHTQMNWNDADWSGIPLEEMIIYELHVGTFT
PEGTFEAIIPRLRELHEFGVNAIELMPIGQFPGNRNWGYDGVFPFAPQHSYGGSEGLKKL
VDAAHQQGISIILDVIYNHFGPEGNYFSDYAPYFTNHYQTAWGNALNFDGEYSYGVRNYF
IENALYWFNNYHIDALRLDASDHLYDIGVKHFLQELAENVDALSKKQGQKFYLTAENDLS
DTKIIRPIESGGYGIDAQWNDAFHHCLHSLLTGEESGYYEDYGTCEQMAKAFKQGFVYSG
QYSPFRKKFHGSDSSAIPGHQFVVFTQNHDQVGNRALGERLTHLVSFKGLKLAAGVLMLA
PNIPLIFMGEEYAEDAPFLYFVSHTDQKLVEVVREGRKKDFAAFHIEGEFIDPFSTETFQ
QCQLNWDKRQEGKHKVMREFYQHLIQLRRTLPALKQLDKENLEASAVEEDKLLFLRRGSS
GDQIFCIMNFNKNKVTCKPSPGGIWRKILDSSDEQWMGSGSTLPEKLIREQEVTIRPQSF
ALYELETLAT
Download sequence
Identical sequences K9WI26
gi|428311890|ref|YP_007122867.1| WP_015183602.1.75295

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]