SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|428311891|ref|YP_007122868.1| from Microcoleus sp. PCC 7113

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|428311891|ref|YP_007122868.1|
Domain Number 1 Region: 87-513
Classification Level Classification E-value
Superfamily (Trans)glycosidases 3.63e-108
Family Amylase, catalytic domain 0.00000000247
Further Details:      
 
Domain Number 2 Region: 3-91
Classification Level Classification E-value
Superfamily E set domains 0.0000000000000144
Family E-set domains of sugar-utilizing enzymes 0.00099
Further Details:      
 
Domain Number 3 Region: 530-604
Classification Level Classification E-value
Superfamily Glycosyl hydrolase domain 0.000024
Family alpha-Amylases, C-terminal beta-sheet domain 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|428311891|ref|YP_007122868.1|
Sequence length 609
Comment maltooligosyl trehalose hydrolase [Microcoleus sp. PCC 7113]
Sequence
MKIGSNYLGEGRCEFTVWAPAHDEVAVQIVSPANRLVPMQKDEQGYFKTLAEGIEPGTLY
FYKIAGDDRPDPASHYQPKDVHGPSQVVDHSQMNWTDASWSGIPLEEMIIYELHVGTFTP
EGTFEAMISRLRELREFGVNAIEIMPVAQFPGDRNWGYDGAYTYAVQHSYGGPESLKKLV
DAAHREGLSVILDVVYNHFGPEGAYYSLYGPYFTEMYKTPWGMAMNFDDKYSDGVRNYFI
ENALYWFQNYHFDALRLDAIHAIYDLGAKHVLQEMAEKVEAFSQSGGRKLYLIAESDLND
VRVIREKELGGHGMDAQWSDDFHHVLHVLLTGEKRGYYQDFGSVEQLAKVYKDSFIYDWK
YAPHRRRYHGSDASDRPGHQFVVCTQNHDQVGNRMLGERLTHLVSFDALKLAAGALLLSP
YIPMLFMGEEYGEDSPFLYFVSHTDQDLVEAVRQGRKREFADFHAEGEFIDPFSVDTFAQ
STLKWEKRQEGKHKVLLELYQHLIQLRRTVPALKTLEKQNLEASSVEEQQLLFLRRGSSG
DQIFCIMNFNKNEVTCKPSTGGIWRKILDSSDEQWMGSGSTLPEKLIREQEVTIAPQSFV
LYQLETLAE
Download sequence
Identical sequences K9WIV6
WP_015183603.1.75295 gi|428311891|ref|YP_007122868.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]