SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|428312120|ref|YP_007123097.1| from Microcoleus sp. PCC 7113

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|428312120|ref|YP_007123097.1|
Domain Number 1 Region: 146-332
Classification Level Classification E-value
Superfamily PP2C-like 0.00000000000000106
Family PP2C-like 0.02
Further Details:      
 
Domain Number 2 Region: 17-125
Classification Level Classification E-value
Superfamily ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase 0.000000596
Family Histidine kinase 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|428312120|ref|YP_007123097.1|
Sequence length 335
Comment anti-sigma regulatory factor [Microcoleus sp. PCC 7113]
Sequence
MIEAVALPIVESSQAGEARRIALALASRLGFNETERGKVGIVVTEAANNLIRHAKDGELV
LQPLTRNEIEGIEILALDKGPGISNISQCLQDGFSTAGTSGTGLGAMSRLSAFFDIYSVP
KLGSACLAQLWANSPSVQPLENDLDKGVVCLPKIGEEISGDAWATAQNCGRTLLLVADGL
GHGPQAAQASREAVRIFQAHSGKSPKEIVEAAHAALRSTRGAALAIAEVDFEQLTVRFAG
VGNISGTIFAAEKSYSMVSYNGTVGHEVRKIQEFVYQWPKGGLLVMHSDGLGTQWRLDRY
PGLVAKHPSLIAGVLYRDFNRGRDDVTVLVVREGK
Download sequence
Identical sequences K9WIR1
WP_015183828.1.75295 gi|428312120|ref|YP_007123097.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]