SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|428312427|ref|YP_007123404.1| from Microcoleus sp. PCC 7113

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|428312427|ref|YP_007123404.1|
Domain Number 1 Region: 1-279
Classification Level Classification E-value
Superfamily Nucleotide-diphospho-sugar transferases 2.04e-75
Family Cytidylytransferase 0.006
Further Details:      
 
Domain Number 2 Region: 243-433
Classification Level Classification E-value
Superfamily Trimeric LpxA-like enzymes 7.53e-31
Family gamma-carbonic anhydrase-like 0.034
Further Details:      
 
Domain Number 3 Region: 636-742
Classification Level Classification E-value
Superfamily Phosphoglucomutase, first 3 domains 1.29e-19
Family Phosphoglucomutase, first 3 domains 0.0085
Further Details:      
 
Domain Number 4 Region: 371-557
Classification Level Classification E-value
Superfamily Phosphoglucomutase, first 3 domains 0.0000000000218
Family Phosphoglucomutase, first 3 domains 0.0028
Further Details:      
 
Domain Number 5 Region: 744-831
Classification Level Classification E-value
Superfamily Phosphoglucomutase, C-terminal domain 0.0000000000837
Family Phosphoglucomutase, C-terminal domain 0.011
Further Details:      
 
Domain Number 6 Region: 532-631
Classification Level Classification E-value
Superfamily Phosphoglucomutase, first 3 domains 0.00000000746
Family Phosphoglucomutase, first 3 domains 0.0027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|428312427|ref|YP_007123404.1|
Sequence length 848
Comment Nucleoside-diphosphate-sugar pyrophosphorylase family protein [Microcoleus sp. PCC 7113]
Sequence
MRAVLMAGGSGTRLRPLTCDLPKPMVPILNRPIAEHIINLLKRHHITEVVATLHYLPDVM
RDYFQDGSDFGVQMTYAVEEDQPLGTAGCVKNIAELLDDTFLVISGDSITDFDLSAAIEF
HKRQNSKATLVLTRVPNPVEFGVVITDEQMRIRRFLEKPSTSEIFSDTVNTGTYILDPSV
LEYLPVNEECDFSKDLFPLLLAKNEPMYGYIAEGYWCDVGHLDAYREAQYDALHQKVELD
FAYAEQKPGLWVGQNTYIDPTAKIETPAIIGSNCRIGPRVTLEAGTVIGDNVTVGADADL
KRPILWNGAIIGEEAHLRACVICRGTRVDRRAHVLEGAVVGPLSTIGEEALVSPGVRVWP
CKRIESGATLNINLIWGQTAQRNLFGQRGVQGLANIDITPEFAVKLGAAYGSTLKPGSQV
AISRDQRSISRMVSRALIAGLMSVGVHVQNLEHTAIPIARLVIPTLSVVGGIHVRVHPDR
PDYILIEIFNSQGINISKGQEKKIEGAYFKEDLRRSQIHEIGNVGYPSQVNDLYSTGFTR
YLNIEAIRNSGSKVVIDYGYSVSGAVLPQLLGKFGCDAVVLNASLNQMGLSTHEREGLLT
QLGHVVEALRANFGAQVSANGEQLILVDESGIPIRGEMLTALMVNVMLTANPRGTVVVPV
QASSAVEQIARRHDGKVIRTKANPTALMEASQANPNVVLGGSGEMGFIFPHLHPGFDAMF
CMAKLIEMLTIQERSLGQIRTDLPRVCHKTYTVRCPWTVKGSLMRHLVETHPNENLELID
GVKIVNHQTDSWVLILPDAGEPLVHIFANSDDRDWVDDSLRKYRNYVQDFVEHEQGVVEP
PKVEAMTS
Download sequence
Identical sequences K9WIG7
WP_015184134.1.75295 gi|428312427|ref|YP_007123404.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]