SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|428312612|ref|YP_007123589.1| from Microcoleus sp. PCC 7113

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|428312612|ref|YP_007123589.1|
Domain Number 1 Region: 36-384
Classification Level Classification E-value
Superfamily Dehydroquinate synthase-like 1.16e-78
Family Iron-containing alcohol dehydrogenase 0.0000101
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|428312612|ref|YP_007123589.1|
Sequence length 406
Comment glycerol dehydrogenase [Microcoleus sp. PCC 7113]
Sequence
MTISQQRDDIPDQSSTDFSATGMNQAPTSLLSLSVAPAQVLRGNQALEQSVDAIARLGKR
PLVVGGDRTLASLTSKLKPVLEQQQLSYSSASYTPDCSEASLSALKEAAASHQADLIIGI
GGGKALDTAKLLAYQCQLPIVTIPTSGATCAAWTALSNIYSDEGAFLYDVSLNHCPDLLI
LDYNLIQTAPQRTLIAGIGDALAKWYEASVSSGSSPVTLIIAAVQQARVLRDILFQKSAD
ALKEPGSEAWREVVDATVLLAGVIGGLGGAQCRTVAAHAVHNGLTHLPSAHDALHGEKVA
YGILVQLRLEEMLQGNQLAASARQQLLKFYSEIGLPQTLEDLGLGNITLAELRKAAEIAC
NPNSDIHRLPFEVVPDQLMAAMVSTTTPVEKSRSPLGLTVAVTDSQ
Download sequence
Identical sequences K9WJ25
WP_015184319.1.75295 gi|428312612|ref|YP_007123589.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]