SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|428312623|ref|YP_007123600.1| from Microcoleus sp. PCC 7113

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|428312623|ref|YP_007123600.1|
Domain Number 1 Region: 448-558
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 0.000000000134
Family Heme-binding PAS domain 0.026
Further Details:      
 
Weak hits

Sequence:  gi|428312623|ref|YP_007123600.1|
Domain Number - Region: 744-832
Classification Level Classification E-value
Superfamily PP2C-like 0.000418
Family PP2C-like 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|428312623|ref|YP_007123600.1|
Sequence length 854
Comment PAS domain-containing protein [Microcoleus sp. PCC 7113]
Sequence
MGTYAAIGYYISWVAVLPANAIIITDFIAANLEPLGITAPETLLRIALTALAFIVSFSGT
RSLGILHLFFVVPAVGFLTVFCVQGMGWLALSPDSPGLLPPNWSTFDFGGWAQWYVIATY
AVYACETASAFIADSQKPRKTLHILVLAAWLIPIVYLGGSWVLMRLATQPGLGDNTYLNL
LAASKPFWGDLAPLLVTFLVLSGSLLSCATAASNSPRMLYQLALDGHISPVFAVTSRQGV
LCPSLVLTLFLSLVWLMWGDLARIVFVTGIGWLFSFIALHWGLWLKRGEPGVLWPRLSLG
FAIFESIALIGGGLAWNWQDLLIGLLLPLVILAGNALMRRISFAPFHPTWWQKLYSKSSR
RLAPDFMLIQVLVLIALVTCATITTWMVKGSLQQFAVDSTTLKNFFVLLLLLITFVEVAI
AGWTSLPQVTSLGEAKEQAEHLFKIAIDSIVVVNEKGVVVQVNPATELLFRTSAFNILQY
HLSEFFPDLEARPDLWENRSEHMFNLNRTSSINPDRNSSHDHRIIEISISSRFHEEFREY
VGILRDITDRKRQKEILEAMVKERTTDLGTANDAIAALNKRLKADNLRMGAELDILRQMQ
QMILPKQQELEDIEELDIAGYMEPADEVGGDYYDVLHTDGIVTIGIGDVTDHGLESGILM
VMAQTAVRTLKEIKEQDPVRFLDTLNRTIYKNVSRMNSGKNLTLAILNYVAGAISISGQH
EETIVVRKGGQIERIDTMDLGLPIGLDEEIADFISHTTVKLEPGDGVVLYTDGIPEARDI
HGKFYEMERLCAAVSQNWHKDAEQVKQSVIEDVRRFIGKQKVFDDITLVVFKRKDDSVVS
AEMQSPSVSSEGMN
Download sequence
Identical sequences K9WK98
gi|428312623|ref|YP_007123600.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]