SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|428312804|ref|YP_007123781.1| from Microcoleus sp. PCC 7113

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|428312804|ref|YP_007123781.1|
Domain Number 1 Region: 207-345
Classification Level Classification E-value
Superfamily Riboflavin kinase-like 3.27e-43
Family ATP-dependent riboflavin kinase-like 0.00014
Further Details:      
 
Domain Number 2 Region: 79-210
Classification Level Classification E-value
Superfamily Nucleotidylyl transferase 3e-21
Family Adenylyltransferase 0.0026
Further Details:      
 
Weak hits

Sequence:  gi|428312804|ref|YP_007123781.1|
Domain Number - Region: 13-43
Classification Level Classification E-value
Superfamily Nucleotidylyl transferase 0.000532
Family Adenylyltransferase 0.032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|428312804|ref|YP_007123781.1|
Sequence length 348
Comment riboflavin kinase/FMN adenylyltransferase [Microcoleus sp. PCC 7113]
Sequence
MWVTSSFATVLTPTAVALGNFDGVHRGHSQVIKPILQQPGAAQSIAMTPPFPEGQGGIEG
LRLPNSKENLERPIRLGKGHTYSTVATFNPHPREFFSGQSWNLLTTRSEKVQQLSLLGVE
QLVLLPFDRELASLSPQEFVEKILMQQLQATHVSVGEDFHFGHRRAGTADELKAIASSYG
VEVSIVSLQMCQGERISSSSIRQSLLEGDISKANLRLGRPYTLTGVVVKGQQLGRKLGFP
TANLQLPPEKFLPKHGVYGVRVHHPTLSSLASSPCAVMNIGHRPTVSGIGVTVEVHLLDW
SGDLYGQTLTVSLEQFLRPEQKFASLEDLKRQIQVDCEAARAVLGCRD
Download sequence
Identical sequences K9WIY8
WP_015184510.1.75295 gi|428312804|ref|YP_007123781.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]