SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|428312937|ref|YP_007123914.1| from Microcoleus sp. PCC 7113

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|428312937|ref|YP_007123914.1|
Domain Number 1 Region: 15-257
Classification Level Classification E-value
Superfamily YjeF N-terminal domain-like 5.49e-56
Family YjeF N-terminal domain-like 0.00012
Further Details:      
 
Domain Number 2 Region: 241-514
Classification Level Classification E-value
Superfamily Ribokinase-like 2.84e-54
Family YjeF C-terminal domain-like 0.0000907
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|428312937|ref|YP_007123914.1|
Sequence length 521
Comment yjeF-like protein, hydroxyethylthiazole kinase-related protein [Microcoleus sp. PCC 7113]
Sequence
MAHTTNRQEQIEQVVVTAQQMREIEGRIFEAGMPVAALMEKVAGLISLRLQALFPLSHYH
RVGVLVGPGHNGGDAAVVARELHLQGYEVLIYRPIAKLKELTSGHTQYAASLGIPVYEQI
EPLQNCDLIIDGLFGFGQTRSLSGNLADAVNRFNQGSQPIVSIDLPSGIHTDTGEVLGTA
VRATRTFCLGLWKLAFLQDQALEYIGKAELIDFGIPAQDVWAILKQPAGLLRMSATVARN
YLPLPRPAVTYKYKEGHLLLICGSRRYAGGAILTGLGARASGVGMLSMAVPESLKPLLVS
HLPEALIIGCPETPAGAIAHLPEAIDLEDYSAIACGPGLTREAKPVIESVIEAQCPLVLD
ADGLNILAELRTIPTLLRRKTPTVLTPHVGEFKRLFPDSAGLLPDRVSAVWKASQLSRAV
VLLKGARTAIAHAGSSVWLIPESTPALARGGSGDVLTGLIGGLVAYPSLSEQPLEAIVAT
AAWWHAQAGILAAQERTELGVDAFTLTQYLMQVVQKATLMP
Download sequence
Identical sequences K9WJY5
gi|428312937|ref|YP_007123914.1| WP_015184643.1.75295

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]