SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|428312938|ref|YP_007123915.1| from Microcoleus sp. PCC 7113

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|428312938|ref|YP_007123915.1|
Domain Number 1 Region: 554-831
Classification Level Classification E-value
Superfamily Subtilisin-like 4.71e-90
Family Subtilases 0.00000136
Further Details:      
 
Domain Number 2 Region: 86-166
Classification Level Classification E-value
Superfamily Hypothetical protein PA1324 1.7e-16
Family Hypothetical protein PA1324 0.0093
Further Details:      
 
Weak hits

Sequence:  gi|428312938|ref|YP_007123915.1|
Domain Number - Region: 406-495
Classification Level Classification E-value
Superfamily Collagen-binding domain 0.00118
Family Collagen-binding domain 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|428312938|ref|YP_007123915.1|
Sequence length 835
Comment subtilisin-like serine protease [Microcoleus sp. PCC 7113]
Sequence
MFLETSSETLGSLSSDTLKHLNTAYLGLSGSDLSSLELSDLWGGNIVQGSSLDPLSVAAS
ERSLETTYTIEQFNDSLIDSQTSISGIQGTKWNDLNGNGVQDTGEAGLAGWTIYLDQNNN
GTLDTGETSTTTDANGNYSFTGLAAGTYTVAEVMQSGWQQTSPGAVTNGSFETGSLTGWN
TIGSTEVQTASYGVTPTQGTYQAVLTNGSGSVTDSALESFFGWSAGTLDGMGNGNATEGS
AMKLSTITVAAGSTLTFDWNFLTNESTPSSYNDFAFVSINGLTELADTNSTFALSPTVFT
EQTGYKKFSYTFRAAGTYTIGLGVVDAGDKTVDSALVVDNFSLTPNGVYQVNLASGQTVN
NINFGSKGVSVLAEPNDTIPSAIDSGLSSSNPGTFKDKGAIGDNPNVASDLDVDFVKFDL
KAGDKATIDIDTNPLVSSLDSFVQVFDSAGNLVAFNDNGAASGETSSLDSFLEFTATTTG
TYYLAVSGKGNSSYNPNVQGSGASGSTGGYNLEVSVIPKFSSNFGYGLVDAAAAVASATG
QDSAFADVAYFGGQNDWGVNAVKAPEAWAQGFTGEGIVVAVIDTGVDYKHPDLDANIWVN
EGEIAGNGVDDDGNGYIDDVNGWDFVAGDNDAMDVYGHGTHVAGTIAAEKNDFGVTGIAY
NAKIMPVKVLDDNGSGSNVDVAAGIKYAADNGADVINLSLGGGYSSEIKDAVEYATAKGA
VVVMAAGNESGSQPGFPASFANQWGVAVGAVDSNNKMADFSNKAGSTELDYVVAPGVDVY
STTPGNTYQSFNGTSMATPHVAGVAALILSANPNLTPAEVESLLTKTANPTAITV
Download sequence
Identical sequences K9WL52
WP_015184644.1.75295 gi|428312938|ref|YP_007123915.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]