SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|428312949|ref|YP_007123926.1| from Microcoleus sp. PCC 7113

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|428312949|ref|YP_007123926.1|
Domain Number 1 Region: 4-247
Classification Level Classification E-value
Superfamily Hsp33 domain 3.4e-64
Family Hsp33 domain 0.00000449
Further Details:      
 
Domain Number 2 Region: 236-295
Classification Level Classification E-value
Superfamily HSP33 redox switch-like 6.02e-20
Family HSP33 redox switch-like 0.00074
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|428312949|ref|YP_007123926.1|
Sequence length 301
Comment disulfide bond chaperone [Microcoleus sp. PCC 7113]
Sequence
MADQLIRATAAEGGIRAVGVITTRLTEEARMRHKLSSEATAALGRTMAGGLLLVSSMKRE
GSRVNIRVKGNGPLGGILVDAGLDGTVRGYVDNPFVELPPNERGKLDVGGVVGREGYLYV
VRDVGYGYPYSSTVELVSGEIGDDLTHYLVNSEQTPSALLLGVLVGTEGVRASGGLLLQV
LPKAARDEALVQTLEERAQIIQQTGLTSLLNAGKTLPEIFEQLLGDMGLVILPEIQMIRF
HCGCSFDRMLGALKILGEAELQDMIEKDDGAEATCHFCGEVYQASSDELAQLIEDLRAES
V
Download sequence
Identical sequences K9WJD8
WP_015184655.1.75295 gi|428312949|ref|YP_007123926.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]