SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|428313031|ref|YP_007124008.1| from Microcoleus sp. PCC 7113

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|428313031|ref|YP_007124008.1|
Domain Number 1 Region: 10-169
Classification Level Classification E-value
Superfamily Restriction endonuclease-like 5.36e-34
Family Hypothetical protein TT1808 (TTHA1514) 0.01
Further Details:      
 
Weak hits

Sequence:  gi|428313031|ref|YP_007124008.1|
Domain Number - Region: 205-244
Classification Level Classification E-value
Superfamily KorB DNA-binding domain-like 0.0183
Family KorB DNA-binding domain-like 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|428313031|ref|YP_007124008.1|
Sequence length 248
Comment hypothetical protein Mic7113_4941 [Microcoleus sp. PCC 7113]
Sequence
MVSQLQSPAHSEVIYPDSDGKPMANNTKQFRWIVVIQQNLDWLFADDPNVFVAGDLFWYP
VEGKPNIVNAPDVMVVFGRPKSDRGSYQQWNEGDIAPQVVFEILSPSNTQDEMERKLLFY
ERYGVEEYYIYDPDRNRLRGWLRTEDGLDIIPQMADWLSPRLGIRFTWSQENLEFYRPDG
ECFLTYVEIAQRFEEERQRAEEERQRADQAEQARRDAIPRLLGMGLSVEQVAEALGLSVE
EVQAIAQE
Download sequence
Identical sequences K9WM65
WP_015184737.1.75295 gi|428313031|ref|YP_007124008.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]