SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|428313158|ref|YP_007124135.1| from Microcoleus sp. PCC 7113

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|428313158|ref|YP_007124135.1|
Domain Number 1 Region: 1-24
Classification Level Classification E-value
Superfamily Zn-binding ribosomal proteins 0.00000134
Family Ribosomal protein L32p 0.0073
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|428313158|ref|YP_007124135.1|
Sequence length 57
Comment 50S ribosomal protein L32 [Microcoleus sp. PCC 7113]
Sequence
MAVPKKKTSKSKRDKRKATWKRKAALQAQKALSLGKAVLSGRSSFVYPTEEEEEEES
Download sequence
Identical sequences K9WLS4
WP_015184862.1.75295 gi|428313158|ref|YP_007124135.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]