SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|428313215|ref|YP_007124192.1| from Microcoleus sp. PCC 7113

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|428313215|ref|YP_007124192.1|
Domain Number 1 Region: 31-253
Classification Level Classification E-value
Superfamily Class I glutamine amidotransferase-like 1.21e-55
Family Class I glutamine amidotransferases (GAT) 0.00000718
Further Details:      
 
Domain Number 2 Region: 210-468
Classification Level Classification E-value
Superfamily Adenine nucleotide alpha hydrolases-like 9.04e-53
Family N-type ATP pyrophosphatases 0.00000319
Further Details:      
 
Domain Number 3 Region: 427-547
Classification Level Classification E-value
Superfamily GMP synthetase C-terminal dimerisation domain 1.44e-52
Family GMP synthetase C-terminal dimerisation domain 0.0000144
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|428313215|ref|YP_007124192.1|
Sequence length 547
Comment GMP synthase [Microcoleus sp. PCC 7113]
Sequence
MTDAAVTLQTGQASHDTETLSTSSLADRLNRQIIVILDFGSQYSELIARRIRETQVYSEV
LSYRTTAEQLRQLNPKGIILSGGPSSVYDTGAPHSDPEIWNLGVPVLGVCYGMQLMVQQL
GGQVTRAERAEYGKASLIIDDPTDLLTNVDDGSTMWMSHGDSCEMLPEGFETLAHTENTP
CAAIAHHEKKLYGVQFHPEVVHSLGGMALIRNFVYHICDCEPTWTTAAFVEEAIREIRGK
VGDKRVLLALSGGVDSSTLAFLLYKAIGEQLTCMFIDQGFMRKGEPERLLKLFKEQFHIP
VEYVNARDRFLEQINGITDPEEKRRRIGHEFINVFEEESRRLGPFDYLAQGTLYPDVIES
ADTNVDPKTGERVAVKIKSHHNVGGLPKDLRFKLIEPLRKLFKDEVRKVGRSIGLPEEIV
NRHPFPGPGLAIRILGEVTSERLNILRDADLVVRQEINRRGIYHDFWQAFAVLLPIRSVG
VMGDQRTYAYPIVLRLINSEDGMTADWSRVPYDLLETISNRIVNEVKGVNRVVYDITSKP
PGTIEWE
Download sequence
Identical sequences K9WLV5
WP_015184919.1.75295 gi|428313215|ref|YP_007124192.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]