SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|428313290|ref|YP_007124267.1| from Microcoleus sp. PCC 7113

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|428313290|ref|YP_007124267.1|
Domain Number 1 Region: 122-277
Classification Level Classification E-value
Superfamily Pentapeptide repeat-like 5.89e-47
Family Pentapeptide repeats 0.00007
Further Details:      
 
Domain Number 2 Region: 30-165
Classification Level Classification E-value
Superfamily Pentapeptide repeat-like 3.14e-38
Family Pentapeptide repeats 0.00024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|428313290|ref|YP_007124267.1|
Sequence length 283
Comment low-complexity protein [Microcoleus sp. PCC 7113]
Sequence
MANAEHLAFLDQGAVGWIKWRTLNPQLEPDLSEANLIGVNLRGAHLQGTNLRKALLDHTL
LIAANLTGANLSQANLSHASLNEANLVEACLIDTTLISADLSHAELTGANLIGADLYGAN
LKGVDLSDANLIGTNLRRVNLQGADLSGAQLLRTNLSEAKLVQANLSHTNLSNANLHEAE
LIGTYLYKAELQKANLSEAHLSGAYLSRANLREADLERADLRWANLSRSNLCEADLKGAN
LRGANLSKANLERADLRGANLRGTNLNKANLQGAMMPDGTTHL
Download sequence
Identical sequences K9WM24
WP_015184994.1.75295 gi|428313290|ref|YP_007124267.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]