SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|428313382|ref|YP_007124359.1| from Microcoleus sp. PCC 7113

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|428313382|ref|YP_007124359.1|
Domain Number 1 Region: 15-238
Classification Level Classification E-value
Superfamily Adenine nucleotide alpha hydrolases-like 8.93e-57
Family PP-loop ATPase 0.00026
Further Details:      
 
Domain Number 2 Region: 217-336
Classification Level Classification E-value
Superfamily MesJ substrate recognition domain-like 1.83e-18
Family MesJ substrate recognition domain-like 0.0034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|428313382|ref|YP_007124359.1|
Sequence length 349
Comment tRNA(Ile)-lysidine synthetase [Microcoleus sp. PCC 7113]
Sequence
MSNRPNWTRLHARVHQTLRQRHLLAQQRRILIAVSGGQDSLCLAKLLLDLQPKWGWQIAI
AHCDHRWPKDEGLVTHVQQLAHNWSLPFYLKTAAELGTSEAAARRWRYQVLCEIAQAEGY
QDVVTGHTKSDRAETVLYNLIRGAGADGLQALTWQRPLVQGLQLVRPLLEVTRAETFQFC
QEHQLPLWEDAYNQDLKYARNRIRQELIPYLKSHFNPQVETALSQTAELLRADVAYLEDA
AQKLRQQAMAPVNGEEQEALFEPCQKATPRINRLVLQPASLALQRRVIRQFLVMVQQGAP
SFEQIEEMTALITAPNRSQTSSFPAGMTAVVEGDWIVLRDNNRVDGREG
Download sequence
Identical sequences K9WL84
WP_015185086.1.75295 gi|428313382|ref|YP_007124359.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]