SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|428313523|ref|YP_007124500.1| from Microcoleus sp. PCC 7113

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|428313523|ref|YP_007124500.1|
Domain Number 1 Region: 13-230
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 2.7e-38
Family Extended AAA-ATPase domain 0.0021
Further Details:      
 
Weak hits

Sequence:  gi|428313523|ref|YP_007124500.1|
Domain Number - Region: 218-275
Classification Level Classification E-value
Superfamily KorB DNA-binding domain-like 0.0549
Family KorB DNA-binding domain-like 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|428313523|ref|YP_007124500.1|
Sequence length 323
Comment DNA polymerase III subunit delta' [Microcoleus sp. PCC 7113]
Sequence
MIHHQPVVSEAFSTLLGQEQAIALLQGAIATNRMAPAYLFAGPPGVGRSMAAKSFIELFF
CQALPPEKQPLVQKRLRQGNHPDVFWVEPTYLHNGIRLSRQEAAEKGLQRKAPPQIRLEQ
IREIAQFLSRSALEASRKMVVIDQAETMAEAAANGLLKTLEEPGQGTLILIAPSAESLLP
TLVSRCQRIPFYRLAQSQMEQVLRQTGHEAILNEPSILAIAQGSPGDAIASFSQLQSIPE
PLLEAVKKRPKSTRHALELAKTIAQSLDTEAQLWLVTYLQHCYWQSQHQPAMIQQLEQAR
KYILSYVQPRLVWEVTLLELIKN
Download sequence
Identical sequences K9WMW8
WP_015185227.1.75295 gi|428313523|ref|YP_007124500.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]