SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|428313629|ref|YP_007124606.1| from Microcoleus sp. PCC 7113

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|428313629|ref|YP_007124606.1|
Domain Number 1 Region: 393-707
Classification Level Classification E-value
Superfamily Subtilisin-like 9.03e-36
Family Subtilases 0.00058
Further Details:      
 
Domain Number 2 Region: 45-139
Classification Level Classification E-value
Superfamily Collagen-binding domain 0.00000000000157
Family Collagen-binding domain 0.0055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|428313629|ref|YP_007124606.1|
Sequence length 727
Comment subtilisin-like serine protease [Microcoleus sp. PCC 7113]
Sequence
MRPGELQDPLHSGNTLISSSSALSTVIPDPGSGPGQAFNIGTLKGNHSQTFTDVVSSTDL
NDYYRLDLSSPGSLSLELTGLSADANLQLFNSNNTLIGSSAQLGNLTEAINLSGLTAGTY
YIDVHPSPSSAGTNYTLNLSTSLESEPSELLPSATSSMNAVTSGVSTDTSSALATNFSVI
DASGDSTAYSVFQGGAIRVSYDFQNVASLSSVRLEALSSSSVVSTLGTWSGASLSSALVN
LASFSTLTAGNYQLRAVIQTTGGQEFLAATQSMSIVSNTRINGTFAADTLNYSAGLGNGA
IILGRGGTDTLNLGAAGLSAANITSINGLSLSAFNPLSGSTANQAIYGGTAFDYLTLSDG
REIYFQGIEFLQFANGSTLELQVHPNDTYFGSQWNLAVSDVPSAWRYSQGASNVLLVSLD
TGLAVGANGLVNTVDIATNRLTSYYWPWANDDFNDYGHGHAAISIMGGTANNASGTAGIN
WNSPVYVNDVYGGNGVGWRLTLQSAIANAINYARTYNMKVVFQGGIQGDGWLNDGGTQAQ
LEQLIQANSDIATFAIAAGNGGPGGNLSDPNYLTSVSGVAKLETAYSNVMSVGALQYQGT
NAVNGITNATAVDLAAYSNRGSNLTLVAATDSPVMDQFGNFVYFNETSAANPNLAGIASL
VWSVNSTLTGGQVRQILTDTAMDLGTLGRDNTFGYGLVNADAAVRRAAALQRNAEVANLY
AGTSLYV
Download sequence
Identical sequences K9WLB8
WP_015185333.1.75295 gi|428313629|ref|YP_007124606.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]