SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|428313707|ref|YP_007124684.1| from Microcoleus sp. PCC 7113

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|428313707|ref|YP_007124684.1|
Domain Number 1 Region: 177-626
Classification Level Classification E-value
Superfamily Six-hairpin glycosidases 1.93e-109
Family Cellulases catalytic domain 0.000000613
Further Details:      
 
Domain Number 2 Region: 84-176
Classification Level Classification E-value
Superfamily E set domains 1.82e-17
Family E-set domains of sugar-utilizing enzymes 0.003
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|428313707|ref|YP_007124684.1|
Sequence length 631
Comment glycosyl hydrolase family protein [Microcoleus sp. PCC 7113]
Sequence
MISGQKGRRPDVACVPCSMEFWGYLPVLNLTLPSSIEIPVSLKVKASDKMKISKMLIFII
VIALSCVFAIAYGFSAKSNAQTPSKAAASKIVINQIGYYPNTTKTALLINLSAPKPGKVQ
LVSNRTKRTVFETGLSAPQQDGASQDIIQTIDFSKFNKEGSYYLKSGNIKSYPFQIGKNI
YRETLSKLLRSYYLQRCGVGVRDSASGVNHPPCHLSDGLIAHTDAFNQGGKHKPAIGGWH
DAGDYGKYVGPTAVTVGRLLSLYEQYPKLFSDRQLAIPESGNRRPDILDEVKIGLDWMLT
MQREDGAVYRKLSGKEWPGAILPHEDKQTRYVYGISTSETAKLAGAMAMAHRIYAPYDSK
LAQIYLKAAQKAWTFLQREPSAKVDWVEGDDSGSGAYLNQSPEGRLQTDKNDRLWAAAEL
FITTGNSAFEQYLVQNIASWTYSLYEWTDPSTLGMTDYLMLTGRKESENLKQQIKTKLLQ
RADSLMQKVAASGYRLANQDFIWASNKRAAEEGITLLHAYRITGNQNYFRAAVDQLDYLL
GRNHFNKSFITGVGSNSVRNVHHRIAQAKKIVIPGLMVGGPNAKAEDGIAPKDLGLLSYL
DDERSYATNEYAIDYNASVIGLMGMLMAQAN
Download sequence
Identical sequences K9WM66
gi|428313707|ref|YP_007124684.1| WP_015185411.1.75295

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]