SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|428313744|ref|YP_007124721.1| from Microcoleus sp. PCC 7113

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|428313744|ref|YP_007124721.1|
Domain Number - Region: 2-56
Classification Level Classification E-value
Superfamily EspE N-terminal domain-like 0.000191
Family GSPII protein E N-terminal domain-like 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|428313744|ref|YP_007124721.1|
Sequence length 63
Comment hypothetical protein Mic7113_5689 [Microcoleus sp. PCC 7113]
Sequence
MTPTTYTRFLRFLQDELAISTDSLAFAQRYREQDPGPLPMILWQYGLVTLEQLDRIYDWL
ETV
Download sequence
Identical sequences K9WLM6
gi|428313744|ref|YP_007124721.1| WP_015185448.1.75295

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]