SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|428313755|ref|YP_007124732.1| from Microcoleus sp. PCC 7113

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|428313755|ref|YP_007124732.1|
Domain Number 1 Region: 1-37
Classification Level Classification E-value
Superfamily L30e-like 0.0000000004
Family RNA 2'-O ribose methyltransferase substrate binding domain 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|428313755|ref|YP_007124732.1|
Sequence length 59
Comment hypothetical protein Mic7113_5700 [Microcoleus sp. PCC 7113]
Sequence
MLTSIQNSLVKQIKKLHHAKGRREQQLFLLEGTHLLEGSIPILQEGKRTGSLFAIFTRE
Download sequence
Identical sequences K9WNE2
gi|428313755|ref|YP_007124732.1| WP_015185456.1.75295

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]