SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|428314185|ref|YP_007125162.1| from Microcoleus sp. PCC 7113

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|428314185|ref|YP_007125162.1|
Domain Number 1 Region: 179-423
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 3.43e-71
Family Extended AAA-ATPase domain 0.0000000295
Further Details:      
 
Domain Number 2 Region: 434-630
Classification Level Classification E-value
Superfamily FtsH protease domain-like 4.71e-69
Family FtsH protease domain-like 0.00000253
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|428314185|ref|YP_007125162.1|
Sequence length 639
Comment ATP-dependent metalloprotease FtsH [Microcoleus sp. PCC 7113]
Sequence
MYDQYLEVNHKMKISWRIILLWTIPALVIGFFLWQGAFSTPAADMGRNTASTRMTYGRFL
EYLDAGRVTSVDLYDGGRTAIVEAVDTELDNRIQRLRVDLPSNAPELVAKLRESNISLDA
HPARNDGAIWGLLGNLIFPILLIAGLFFLFRRSSNINGGPGQAMNFGKSKARFQMEAKTG
ILFNDVAGIEEAKEELQEVVTFLKQPERFTAVGARIPKGVLLVGPPGTGKTLLAKAIAGE
AGVPFFSISGSEFVEMFVGVGASRVRDLFKKAKENAPCLVFIDEIDAVGRQRGAGIGGGN
DEREQTLNQLLTEMDGFEGNTGIIIIAATNRPDVLDTALLRPGRFDRQVIVDAPDMKGRV
GILDVHARNKKLAPEVSIETIARRTPGFTGADLANLLNEAAILTARRRKEAITMLEINDA
VDRVVAGMEGTPLVDSKSKRLIAYHEIGHAIVGTLVKDHDPVQKVTLIPRGQAQGLTWFT
PNEEQGLITRAQLKARITGALGGRAAEEEIFGYSEVTTGAGGDLQQVTGMARQMVTRFGM
SDLGPMSLESQEGEVFLGGGLTSRAEYSEVVASRIDEQVRVIVEHCHDDARRIIRDNRVV
IDRLVDLLIEKETIDGEEFRQIVAEYTDVPDKEQYVPQL
Download sequence
Identical sequences K9WPM1
gi|428314185|ref|YP_007125162.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]