SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|428314242|ref|YP_007125219.1| from Microcoleus sp. PCC 7113

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|428314242|ref|YP_007125219.1|
Domain Number 1 Region: 6-149
Classification Level Classification E-value
Superfamily Ribosomal protein S7 1.44e-61
Family Ribosomal protein S7 0.00000376
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|428314242|ref|YP_007125219.1|
Sequence length 156
Comment 30S ribosomal protein S7 [Microcoleus sp. PCC 7113]
Sequence
MSRRTVIKKRPIPPDPVYNNRLISMMVRRIMRHGKKSIANRIIYDAMKIIEERTGNDPLD
TFESAVKNVTPLVEVKARRVGGATYQVPMEVRSDRGTTLALRWLIRFSRERGGRSMASKL
ANELMDAANGTGNAIRKREETHRMAEANKAFAHYRY
Download sequence
Identical sequences K9WNP7
WP_015185941.1.75295 gi|428314242|ref|YP_007125219.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]