SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|428314455|ref|YP_007125431.1| from Microcoleus sp. PCC 7113

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|428314455|ref|YP_007125431.1|
Domain Number 1 Region: 33-167,219-354
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.23e-35
Family Tandem AAA-ATPase domain 0.0097
Further Details:      
 
Weak hits

Sequence:  gi|428314455|ref|YP_007125431.1|
Domain Number - Region: 387-421
Classification Level Classification E-value
Superfamily Rubredoxin-like 0.0847
Family Rubredoxin 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|428314455|ref|YP_007125431.1|
Sequence length 537
Comment DNA/RNA helicase [Microcoleus sp. PCC 7113]
Sequence
MNSFLTNSTNPFTTKNSKFYQLRDYQQSLVQDIFTAWDSGYQSVLAILPTAGGKTICFVE
VASTFLAKNQPVLVIAHLEELITQAADKLAMLGVRVGIIKAGYEADPDALIQVASIQTLV
RRELPSSALVIFDEAHHCASRTYSEIMLHYRETGAKILGVTATPNRPDGRGLRSLDKGVP
GFDSLVSGPSSGQLIEKGYLCRFSIYAASQLLDAQQAGIETTDGDYDTEQLTEYVKKTLV
LGDVVATWKKHAFGLRTVVFAVSVPHAKELAIAFCDAGIAAEEVNGKTPPETRRTILSRF
ARGETLVLCQHSLLIEGVDVPGIQCVQFCRPTQSLIVWLQAIGRALRPAPGKELALVLDH
THNHTTLPWPDSEIAWSLEPAQIKPDKNTHTCSECNHVFRPTSSEWNSGSAHCPACGATL
SLPERQFNQQPETVEQEADAEEKVETKRQNLIEVLPANFTQVSPLPDSKKMKQVYRLLKI
QQECGYKKGWLLYRLQEMENELQLGLTEWQEVGKLLDYNPKWALMRWKEFALRQGNN
Download sequence
Identical sequences K9WNP4
gi|428314455|ref|YP_007125431.1| gi|428314455|ref|YP_007125431.1|NC_019739 WP_015186152.1.75295

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]