SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|428314825|ref|YP_007151056.1| from Microcoleus sp. PCC 7113

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|428314825|ref|YP_007151056.1|
Domain Number 1 Region: 29-125
Classification Level Classification E-value
Superfamily ParB/Sulfiredoxin 1.22e-26
Family ParB-like nuclease domain 0.00018
Further Details:      
 
Domain Number 2 Region: 113-145,178-257
Classification Level Classification E-value
Superfamily KorB DNA-binding domain-like 1.96e-19
Family KorB DNA-binding domain-like 0.0025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|428314825|ref|YP_007151056.1|
Sequence length 311
Comment transcriptional regulator [Microcoleus sp. PCC 7113]
Sequence
MSRRKRSPQPYQIKGVDALFGEQSSTEEAAQRIPLSQIRLPQAQPRRYFEPQAMQSLVES
VKQHGILSPLLVRPKGQDLYELVAGERRYRAAVSAGLDEVSVVIRELTDEDALQLALLEN
LQREDLNPLEETEGILQLLALKLNQTPESAIALLNAAAHPERNSVDNVIHSPEWQTVIDV
FTSVGKFTPESFRTNRLPLLNLPDDIKEALRSGRLSYTKARAIARVKGQLERQELLDAAI
SEDLSLNEIKDRIKSLQPTNVTLDEGQPASLKSRVDKAYAKIKKSKIWDDPKKKRQLEKL
LAQLEALCVKV
Download sequence
Identical sequences K9WRE8
WP_015211603.1.75295 gi|428314825|ref|YP_007151056.1|NC_019762 gi|428314825|ref|YP_007151056.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]