SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|471263860|ref|YP_007646714.1| from Hydrogenobaculum sp. SN

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|471263860|ref|YP_007646714.1|
Domain Number 1 Region: 83-175
Classification Level Classification E-value
Superfamily Ribosomal protein L6 2.36e-33
Family Ribosomal protein L6 0.000058
Further Details:      
 
Domain Number 2 Region: 1-82
Classification Level Classification E-value
Superfamily Ribosomal protein L6 6.37e-27
Family Ribosomal protein L6 0.00025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|471263860|ref|YP_007646714.1|
Sequence length 181
Comment ribosomal protein L6, bacterial type [Hydrogenobaculum sp. SN]
Sequence
MSRIGKKPIAIPNNVKVSLDGNVLTIEGPKGKLSMPVHEIVNVKIDNNQITVSKNQDSPF
AQAMHGTTAALIKNMIEGVSKGYSVTLEVVGLGYKAAMKGQELELNLGYSHPIYYKPPAG
IKLEVKENKITVSGIDKQLVGQVAAEIIKFRKPDPYKGKGIRYEGQVLKLKPGKSAGKGK
K
Download sequence
Identical sequences M1RRJ3
2014007676 2014290436 gi|471263860|ref|YP_007646714.1| WP_015418911.1.67077 WP_015418911.1.67908 WP_015418911.1.87448 WP_015418911.1.9515 gi|452943493|ref|YP_007499658.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]