SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|471264084|ref|YP_007646938.1| from Hydrogenobaculum sp. SN

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|471264084|ref|YP_007646938.1|
Domain Number 1 Region: 5-158
Classification Level Classification E-value
Superfamily Ligand-binding domain in the NO signalling and Golgi transport 7.85e-25
Family MJ1460-like 0.0062
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|471264084|ref|YP_007646938.1|
Sequence length 162
Comment putative hydrocarbon binding protein (contains V4R domain) [Hydrogenobaculum sp. SN]
Sequence
MEFRDNLRILAEAIERESVLIHRSALIDGYKELFKLNKLGIGTFIKKAAELGGKKGAITL
KERYEVTTDKLSEALDLLTIIAESSRLITFMETSVENMEIYVEGSILVEAIPQSKKPVCE
PMAGFFSGFLTELLQTKYNVVEVSCQAQGHEKCTFKIKKEAK
Download sequence
Identical sequences M1QI31
gi|452943721|ref|YP_007499886.1| WP_015419131.1.67077 WP_015419131.1.67908 WP_015419131.1.87448 WP_015419131.1.9515 gi|471264084|ref|YP_007646938.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]