SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Coclu2|27061|fgenesh1_kg.5_#_15_#_gnl|Clun|Contig_5530 from Cochliobolus lunatus m118 v2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Coclu2|27061|fgenesh1_kg.5_#_15_#_gnl|Clun|Contig_5530
Domain Number 1 Region: 3-120
Classification Level Classification E-value
Superfamily dUTPase-like 7.33e-42
Family dUTPase-like 0.0000197
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Coclu2|27061|fgenesh1_kg.5_#_15_#_gnl|Clun|Contig_5530
Sequence length 134
Sequence
AFAAGHDLYSAVDIVIPARGRALVGTDIKVSVPVGTYGRVAPRSGLAYKHGIDTLAGVID
ADYRGPVGVILANLSDTDFPIKIGDRIAQLVVEKIVMPNVVVVDELEESVRGAGGFGSTG
GFGTGAAAEEVKKA
Download sequence
Identical sequences jgi|Coclu2|27061|fgenesh1_kg.5_#_15_#_gnl|Clun|Contig_5530

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]