SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Coclu2|50209|fgenesh1_pm.7_#_234 from Cochliobolus lunatus m118 v2.0

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  jgi|Coclu2|50209|fgenesh1_pm.7_#_234
Domain Number - Region: 67-117
Classification Level Classification E-value
Superfamily MgtE N-terminal domain-like 0.0706
Family MgtE N-terminal domain-like 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Coclu2|50209|fgenesh1_pm.7_#_234
Sequence length 221
Sequence
MPAATNSDPRSPSPVPARPIAETPGPRAQGLINVFNQASKATLDKCSAKNFASCFPTAAQ
YSPEVLDNLRGQIVDQLDRTWKSNFEDIMERRNVVKLLNSLDQCIEDARLRKKRAEESAN
GGAVETPVPPHTLTPAEIHLAHLMPFLEKQATDMNAKLTETQQSNKELLSTVTAQRAEIE
ALVRGLENVIQDLEASAQTMAQDDVQDLSKETRDLEMAMRT
Download sequence
Identical sequences jgi|Coclu2|50209|fgenesh1_pm.7_#_234

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]