SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|528828870|ref|YP_008364826.1| from Rhizobium etli bv. mimosae str. Mim1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|528828870|ref|YP_008364826.1|
Domain Number 1 Region: 6-96
Classification Level Classification E-value
Superfamily YccV-like 2.09e-34
Family YccV-like 0.0016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|528828870|ref|YP_008364826.1|
Sequence length 109
Comment hemimethylated DNA-binding domain-containing protein [Rhizobium etli bv. mimosae str. Mim1]
Sequence
MKERIAKFSIGEVVRHKVFPFRGVIFDVDPEFANTEEWWNSIPAEVRPSKDQPFYHLLAE
NDESEYVAYVSEQNLVNDESGTPLRNPQIYQIFDQAPSGQFKPKMSFAH
Download sequence
Identical sequences A0A246SB09 A0A2A6JZU9 K0VRL1 Q2K8F1 S5SID3
WP_008526562.1.55012 WP_008526562.1.62937 WP_008526562.1.76939 WP_008526562.1.93170 WP_008526562.1.95887 gi|86357720|ref|YP_469612.1| gi|528828870|ref|YP_008364826.1| 347834.RHE_CH02101

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]