SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|528832563|ref|YP_008367362.1| from Rhizobium etli bv. mimosae str. Mim1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|528832563|ref|YP_008367362.1|
Domain Number 1 Region: 1-275
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 2.1e-53
Family Phosphate binding protein-like 0.0000465
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|528832563|ref|YP_008367362.1|
Sequence length 280
Comment octopine ABC transporter substrate-binding protein OccT 3 [Rhizobium etli bv. mimosae str. Mim1]
Sequence
MKFSTILFCGAAALSAFAAPAFAKDWTKATITLEGAYAPWNLTNADGTLGGFEPELAKVL
CERAKIECTLVASDWDGMIPALNAGKFDVIMDALSITEERRQVIDFTIPYAATPAAFATA
KDSPLAKAAGTGATIKMTPGQTGVKEIDALKEAFKGKTIGIQAATVYAKFVYDNFGDIAE
IREYKTGADRDLDLQNGRIDLGFDDAVYFANAFQAANGALDFTGPEIVGSIWGEGEGLGI
RKADTDLRDKFNVAIKSALADGTVKSLSMKWFKVDVSPQQ
Download sequence
Identical sequences S5S476
gi|528832563|ref|YP_008367362.1|NC_021908 WP_020922979.1.76939 WP_020922979.1.93170 gi|528832563|ref|YP_008367362.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]