SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|470212231|ref|YP_007614593.1| from Sphingomonas sp. MM-1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|470212231|ref|YP_007614593.1|
Domain Number 1 Region: 64-512
Classification Level Classification E-value
Superfamily PLP-dependent transferases 4.23e-96
Family Glycine dehydrogenase subunits (GDC-P) 0.00000000857
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|470212231|ref|YP_007614593.1|
Sequence length 521
Comment glycine dehydrogenase subunit 2 [Sphingomonas sp. MM-1]
Sequence
MSINQSGWRPEMAGGEAAPVKTFTGNKGLMLEEALIFEIGDSERTGVDLPEAPKVASRLG
GLERTAAIGLPGLSEPEAVRHYTRLSRQNYAIDLGLFPLGSCTMKHNPRLNERMARLPGF
ADIHPLQPVDSVQGALALIHLVGEWLVKLTGMAAVAMSPKAGAHGELCGLLAIRSALEAR
GDARKVILVPESAHGTNPATAAFCGYAVENIPATAAGRVDLEALKARLGPDVAAVMITNP
NTCGLFEPDMKAISDAVHAAGALVYCDGANFNAIVGRVRPGDLGVDAMHINLHKTFSTPH
GGGGPGSGPVVFSESLAPYAPLPFVEKQGDHYALVEEETAGEHHAGSFGRMVAFHGQMGM
FVRAAAYMLSHGADGLKQVSEDAVLNANYILRSLESVLDAPFAASGPCMHEALFSDDNLP
EGFSTLDIAKGLIDEGFHPMTVYFPLVIHGAMLVEPTETESKAALDQFIGALRSVGERAK
AGDPALKSAPHLAPRRRLDETLAARKPILVWKEPAAAQAAE
Download sequence
Identical sequences M4SBH8
gi|470212231|ref|YP_007614593.1| WP_015457014.1.78711

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]