SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|222157806|ref|YP_002557945.1| from Escherichia coli LF82

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|222157806|ref|YP_002557945.1|
Domain Number 1 Region: 1-362
Classification Level Classification E-value
Superfamily FMN-linked oxidoreductases 1.69e-109
Family FMN-linked oxidoreductases 0.0000000000112
Further Details:      
 
Domain Number 2 Region: 333-519
Classification Level Classification E-value
Superfamily Nucleotide-binding domain 5.53e-42
Family N-terminal domain of adrenodoxin reductase-like 0.0000003
Further Details:      
 
Domain Number 3 Region: 467-627
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 4.72e-27
Family C-terminal domain of adrenodoxin reductase-like 0.0000000656
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|222157806|ref|YP_002557945.1|
Sequence length 672
Comment 2,4-dienoyl-CoA reductase [NadPH] [Escherichia coli LF82]
Sequence
MSYPSLFAPLDLGFTTLKNRVLMGSMHTGLEEYPDGAERLAAFYAERARHGVALIVSGGI
APDLTGVGMEGGAMLNDANQIPHHRTITEAVHQEGGKIALQILHTGRYSYQPHLVAPSAL
QAPINRFVPHELTHEEILQLIDDFAHCAQLAREAGYDGVEVMGSEGYLINEFLTLRTNQR
SDQWGGDYRNRMRFAVEVVGAVRERVGNDFIIIYRLSMLDLVEGGGTFAETVELAQAIEA
AGATIINTGIGWHEARIPTIATPVPRGAFSWVTRKLKGHVSLPLVTTNRINDPQVADDIL
SRGDADMVSMARPFLADAELLSKAQSGRADEINTCIGCNQACLDQIFVGKVTSCLVNPRA
CHETKMPILPAVQKKNLAVVGAGPAGLAFAINAAARGHQVTLFDAHSEIGGQFNIAKQIP
GKEEFYETLRYYRRMIEVTGVTLKLNHTVTADQLQAFDETILASGIVPRVPPIDGIDHPK
VLSYLDVLRDKAPVGNNVAIIGCGGIGFDTAMYLSQPGESTSQNIAGFCNEWGIDSSLQQ
AGGLSPQGMQIPRSPRQIVMLQRKASKPGQGLGKTTGWIHRTTLLSRGVKMIPGVSYQKI
DDDGLHVVINGETQVLAVDNVVICAGQEPNRALAQPLIDSGKTVHLIGGCDVAMELDARR
AIAQGTRLALEI
Download sequence
Identical sequences A0A0H3EPR0
WP_000121409.1.16927 WP_000121409.1.55896 WP_000121409.1.60096 WP_000121409.1.63305 WP_000121409.1.63433 WP_000121409.1.72298 WP_000121409.1.76759 WP_000121409.1.85125 YP_006121412.1.29421 gi|222157806|ref|YP_002557945.1| gi|387618390|ref|YP_006121412.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]