SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|374983092|ref|YP_004958587.1| from Streptomyces bingchenggensis BCW-1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|374983092|ref|YP_004958587.1|
Domain Number 1 Region: 37-313
Classification Level Classification E-value
Superfamily Transmembrane di-heme cytochromes 5.97e-59
Family Cytochrome b of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) 0.0000388
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|374983092|ref|YP_004958587.1|
Sequence length 557
Comment cytochrome B subunit [Streptomyces bingchenggensis BCW-1]
Sequence
MDNCALEPAAQEIAEATANAGRSTEPQRGRRGEKVAEWTRGRLGVRNLTRAGMRKAFPDH
WSFMLGEICLYSFLIVIATGIYLSLYFHPTMNQVEYRGSYLPLRGQMVSEAFDSTMHISF
DVRGGLLIRQAHHWAALIFVAGIFVHMMRVFFTGAFRRPRELNWVFGFLLLLLAMFAGLT
GYDLPGDLLSGTGLVVVNGTLLSVPIVGTYLSMFLFGGEFPGNDLVARFNAIHVLVIPGL
MVGLIVAHLILVFRHKHTQYPGPGRTNRNVIGMPLRVHAVKAAGYFFLVTGVIFVIASIA
QINPIWEYGPYRPDQVSAGSQPDWYMGVADGLIRVMPGWEISIWGHTLALDNLIPLLAGV
GLFLVMGAYPFIEAWVTDDDREHHLLDRPRNRPVRTGLGAAWISVYLVALTGAGNDIIAT
QFHVSVNSVTWAVRIGLFLVPIAVYAVTKRWALGLQRRDRDKVLHGRETGIIKRLPHGEF
VEVHEPLSRERLHILTAHEQYQPIESGGPGVQGGPVRSTSRTRRLRARLSRGFYGEGTQI
PKPTVQEYEEITSGHRR
Download sequence
Identical sequences D7BYC8
WP_014172935.1.69245 WP_014172935.1.9551 gi|374983092|ref|YP_004958587.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]