SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|374985214|ref|YP_004960709.1| from Streptomyces bingchenggensis BCW-1

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|374985214|ref|YP_004960709.1|
Domain Number - Region: 11-82
Classification Level Classification E-value
Superfamily Transmembrane di-heme cytochromes 0.0596
Family Formate dehydrogenase N, cytochrome (gamma) subunit 0.097
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|374985214|ref|YP_004960709.1|
Sequence length 122
Comment putative integral membrane protein [Streptomyces bingchenggensis BCW-1]
Sequence
MIDALTVALGVTALALASWCGFATYRDQPTKDWHFIGMAVVTLLGLVQLVIGIVQLARGQ
RPDESVAIFVAYLVGSGLAVPIAAFMSLAERTRWGSATVAAAAVVLAVLEVRLYDIWGGT
GA
Download sequence
Identical sequences D7BX33
gi|374985214|ref|YP_004960709.1| WP_014175055.1.69245 WP_014175055.1.9551

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]