SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|374985416|ref|YP_004960911.1| from Streptomyces bingchenggensis BCW-1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|374985416|ref|YP_004960911.1|
Domain Number 1 Region: 185-476
Classification Level Classification E-value
Superfamily Subtilisin-like 6.81e-83
Family Subtilases 0.00000183
Further Details:      
 
Domain Number 2 Region: 765-870
Classification Level Classification E-value
Superfamily PA domain 0.000000000288
Family PA domain 0.0061
Further Details:      
 
Weak hits

Sequence:  gi|374985416|ref|YP_004960911.1|
Domain Number - Region: 1152-1205
Classification Level Classification E-value
Superfamily E set domains 0.0049
Family Molybdenum-containing oxidoreductases-like dimerisation domain 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|374985416|ref|YP_004960911.1|
Sequence length 1217
Comment peptidase S8/S53 subtilisin kexin sedolisin [Streptomyces bingchenggensis BCW-1]
Sequence
MAVTGAAGLLSGLAAPVASGQPSQAAPKGPSVRAEHTVTLITGDTVTVTPGDDGRYAVDV
KRAPGRESVDFVASQQGKEISVVPDDALKLLSAGRLDASLFNITQLVKDGYDDKKTGSLP
VIATYRTKGAHPTPEGARKTLTLSSVGGAAFSAKKADAAAFWADISHAKGLAKLWLDRKV
KVSLDVSVPQIGAPEMWKAGYDGKGVKVAVLDTGVDAAHPDVKDSVAESKSFVPDETVQD
GFGHGTHVAATIAGGGAASDGKRKGVAPGAKLLVGKVLNNAGEGYSSWIIEGMEWAAASG
AKVISMSLGGTASGPSDPMSEAVDQLSASSGALFVIAAGNAGPFEQTLGTPGIADSALTV
GAVDKQDKLASFSSRGPRIGDSAVKPEITAPGVAITAARAAGTSMGTPVDDLYTTANGTS
MATPHVAGSAAIVAQAHPDWTGQQIKAALASTAKTNTANDPFQQGDGRVDVPRAVTQNVF
ATPTLSYGLYGYADDAPDTKSIAYTNATEKPVTLKLASSVDGGSLSLESDSVTVPANGAA
KVAVTVDPAKADVGRHTGYITATSEDGTVKVTTAVGYEREADLYDLKVELLNREGKPVPS
ALYTFQNLADYTYNQFGAMRGSETFRVEKGTYSLATWIPILDSGRHEVGTSIVGDPQIEV
TGDTSITLDARKAVEIKPQTKEKDAELQGVTTSWHREREGGSSFGLTYIMGKWKKHIYAA
PTKQVTDGSFEFYSRWRLEKKKLTASVTSPERVTLNPEYANTYTGWPVKITGNRKVRLVD
AKGGTAEDFEGLDVKGKAVLVGLAPDGWPDEAVVNATKAGAAYVLVYRKNTAGLWLTAVD
SATIPVISIPGEEGDKLLSLLTAKGRSAVTLELGGTAVSPYVYDVLLPEPGAIGEDLTYP
LDSRSTTKVTARYHGSAKGQIGAEATHTFRPYQLFSLESKYDVPLGTQRTEYYSADPDTR
VWRTAMQDYDGAGRQWAPLVTYRPGTKQTVDWLSPVFRPTTAAEFGVSQREGDELTLAIP
EYADSGSGHYGSAGAAKDNVDKVKTSLYADGKLVGEAPYGSGTFQVPTDKAAYKLTIDAE
RTAAWAAYSTKTSTEWDFTSARTAEAKALPLLSVDYDLDLDLFGRTEAGRRFSFQLAPRH
QEGAEESKVKAVKAWVSYDDGKTWKEARLTGSRAGYKATVKHPALGASNGFVALRVQATD
ADGNRIDQTVTRAYGLK
Download sequence
Identical sequences D7C0Q8
gi|374985416|ref|YP_004960911.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]