SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|374986602|ref|YP_004962097.1| from Streptomyces bingchenggensis BCW-1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|374986602|ref|YP_004962097.1|
Domain Number 1 Region: 11-111
Classification Level Classification E-value
Superfamily Putative DNA-binding domain 3.08e-20
Family DNA-binding N-terminal domain of transcription activators 0.003
Further Details:      
 
Domain Number 2 Region: 202-296
Classification Level Classification E-value
Superfamily Probable bacterial effector-binding domain 0.00000000000855
Family Multidrug-binding domain of transcription activator BmrR 0.041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|374986602|ref|YP_004962097.1|
Sequence length 299
Comment putative transcriptional regulator, MerR family protein [Streptomyces bingchenggensis BCW-1]
Sequence
MLRRVNDDDPLSIGQFARLVRLSVKQLRHYADLGLLPPARVDPDTGYRYYRADQARDAMS
IGLLRSLDVPLAAIKDVLSGQDPARALGDVRDRLDDELARRRRSLAALERILAGGLPTAE
VTLRREEPQRVAVVRDVADSPEDIGRVTGACVGRLLALLAAGEHAERGERGVQGPPEAGP
PWEGQPGKKPPGEGLRLVGLFPVDMGEYIPITITAALPEGRPAPPGTTVDLLPGGTFACA
THTGAYDQISLTAHALVAWCVERGHAPTGPIRELYLNDPAVTAPDHLVTQLLIPLEETP
Download sequence
Identical sequences D7CHA9
WP_014176440.1.69245 WP_014176440.1.9551 gi|374986602|ref|YP_004962097.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]