SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|374988244|ref|YP_004963739.1| from Streptomyces bingchenggensis BCW-1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|374988244|ref|YP_004963739.1|
Domain Number 1 Region: 180-385
Classification Level Classification E-value
Superfamily DNA ligase/mRNA capping enzyme, catalytic domain 4.56e-44
Family ATP-dependent DNA ligase catalytic domain 0.00085
Further Details:      
 
Domain Number 2 Region: 387-510
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 4.28e-30
Family DNA ligase/mRNA capping enzyme postcatalytic domain 0.002
Further Details:      
 
Domain Number 3 Region: 4-202
Classification Level Classification E-value
Superfamily ATP-dependent DNA ligase DNA-binding domain 1.83e-25
Family ATP-dependent DNA ligase DNA-binding domain 0.0033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|374988244|ref|YP_004963739.1|
Sequence length 512
Comment ATP-dependent DNA ligase [Streptomyces bingchenggensis BCW-1]
Sequence
MLLAEVARTSREVAATSARSEKIAALARLLSRVEPAEAPVVITYLAGRLPQRRIGVGWAG
LRVRPEPAAGPRLGVLDVHQALDRVAAVSGTGATTERKRLVSGLMSAATEDEQAFLFGLI
GGELRQGALDALAVEGLSAAVGAPPAEVRRAVMLGGSLGAVAQALLENGPPALSEFGLEV
GRPVLPMLAHSARDLDEALDRLGPCAVEEKLDGIRVQVHRDKETVRVYTRTLDEITDRLP
EVVAAARELAVERAVLDGEVIALDADGRPRPFQEISGRVGARLDVAGASASLPLYPVFFD
LLAVDDRDLLDLSARDRHAELARVAPAPRRVRRLVAEDPRDEATRRAAREFAADVLARGH
EGVMAKSLDAPYSAGRRGACWLKVKPVHTLDLVVLAAEWGHGRRTGKLSNLHLGARRPDG
TYAMLGKTFKGLTDKQLGWQTEALLRLAVSDDGWVVRVRPELVVEVAFDSLQRSSRYPEG
VTLRFARVLRYREDKPAEEADTVETVLALRDA
Download sequence
Identical sequences D7CAP1
WP_014178072.1.69245 WP_014178072.1.9551 gi|374988244|ref|YP_004963739.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]