SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|374989135|ref|YP_004964630.1| from Streptomyces bingchenggensis BCW-1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|374989135|ref|YP_004964630.1|
Domain Number 1 Region: 126-285
Classification Level Classification E-value
Superfamily Probable bacterial effector-binding domain 6.8e-22
Family Gyrase inhibitory protein GyrI (SbmC, YeeB) 0.07
Further Details:      
 
Domain Number 2 Region: 55-106
Classification Level Classification E-value
Superfamily Homeodomain-like 0.00000000354
Family AraC type transcriptional activator 0.018
Further Details:      
 
Domain Number 3 Region: 3-53
Classification Level Classification E-value
Superfamily Homeodomain-like 0.0000000228
Family AraC type transcriptional activator 0.0074
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|374989135|ref|YP_004964630.1|
Sequence length 290
Comment putative AraC family transcriptional regulator [Streptomyces bingchenggensis BCW-1]
Sequence
MLDRLNHAMEHIERHLDQSIDGAGLARIAATSEYHLRRMFSALAGMPLSEYIRRRRLTVA
GAEVLAGDVSLLEIAVRYGYGSGEAFARAFRAMHGVGPGEARRSGAALVSQPRLTFRLTI
EGSSSMRYRVVDRPAFSVVGLKARVPLVHVGPNQAIIDFIRGIEPGTLERLEKLSDLEPQ
GIVAVCDDLDPSRAEGTELDYYHGVITSAAPPEGAAVLPVPAGSWAVFTTSGPMPEAIQY
LWRDVFTEWFPSNPYRSRPGPEILRTRLSPDKTEADAELWLPVEREQERS
Download sequence
Identical sequences D7BTT0
gi|374989135|ref|YP_004964630.1| WP_014178950.1.69245 WP_014178950.1.9551

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]