SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|374989335|ref|YP_004964830.1| from Streptomyces bingchenggensis BCW-1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|374989335|ref|YP_004964830.1|
Domain Number 1 Region: 41-275
Classification Level Classification E-value
Superfamily Hypothetical protein YwqG 0.0000000017
Family Hypothetical protein YwqG 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|374989335|ref|YP_004964830.1|
Sequence length 280
Comment hypothetical protein SBI_06579 [Streptomyces bingchenggensis BCW-1]
Sequence
MDPESRLSALRDFCAERLGPQLAARYVDLARPGFALTAAENPGEAAGHSRFGGRAMLEPG
TPWPTCDGFPLSLIAVLDADTLSPWLGDVLPAGTGLLNFFCLDAESEQHDPVSYDLMNKY
GHYEVEVSSVIPARFAHAVETDPPARSSVFEPIPWAAKPGFAFPDTWDPAWNGFDVGPDA
DDMARAMPGNYVENQLTEWSERPGALDSEDMAFGRPQFPTGSSPMVPFGKDPNRYHHLLQ
LASYEEWSIGGDGGWMHWAIPTDALRIGDFGQAVPTPDIW
Download sequence
Identical sequences D7BVX0
WP_014179149.1.69245 WP_014179149.1.9551 gi|374989335|ref|YP_004964830.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]