SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|374989881|ref|YP_004965376.1| from Streptomyces bingchenggensis BCW-1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|374989881|ref|YP_004965376.1|
Domain Number 1 Region: 1-101
Classification Level Classification E-value
Superfamily L21p-like 7.72e-31
Family Ribosomal protein L21p 0.0002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|374989881|ref|YP_004965376.1|
Sequence length 106
Comment 50S ribosomal protein L21 [Streptomyces bingchenggensis BCW-1]
Sequence
MYAIVRTGGRQQKVSVGDVIEVDRLSSSKVGDTVELSTLLVVDGDAVTSDPWVLAGVKVQ
AEVVDHHKGAKIDILKYKNKTGYRKRIGHRQLHTALKITSIDAAAK
Download sequence
Identical sequences A0A229HE77 D7C3M0
gi|374989881|ref|YP_004965376.1| WP_014179695.1.69245 WP_014179695.1.89855 WP_014179695.1.9551

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]