SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|374990607|ref|YP_004966102.1| from Streptomyces bingchenggensis BCW-1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|374990607|ref|YP_004966102.1|
Domain Number 1 Region: 12-272
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 3.51e-71
Family Protein kinases, catalytic subunit 0.00000389
Further Details:      
 
Domain Number 2 Region: 587-646
Classification Level Classification E-value
Superfamily Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.000000107
Family Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.0085
Further Details:      
 
Weak hits

Sequence:  gi|374990607|ref|YP_004966102.1|
Domain Number - Region: 385-445
Classification Level Classification E-value
Superfamily Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.00706
Family Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.015
Further Details:      
 
Domain Number - Region: 518-581
Classification Level Classification E-value
Superfamily Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.0183
Family Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|374990607|ref|YP_004966102.1|
Sequence length 649
Comment serine/threonine protein kinase [Streptomyces bingchenggensis BCW-1]
Sequence
MDTTLHDPLVGQLLDGRYRVEARIAAGGMATVYRAVDTRLDRVLALKVMHQSLATDDAFV
ERFIREAKSVARLAHPNVVGVFDQGTDGSHVYLAMEYVAGCTLRDVLRERGALQPRAALD
ILEPVLAALGAAHRAGFVHRDMKPENVLIGDDGRVKVADFGLVRAVDTNTNASTGTLLGT
VSYLAPEQIEHGTADTRADVYACGVMLYEMLTGAKPHTGTVPAQVLYQRLNEDVPPPSAL
APGVAPQLDELVAAATARELGQRPADAVELLGLARTARGALTDEQLDAVPPQAKADAHDG
SEDRTSVIPRPVGGIGGPVPADEQQLNLTSRLELPPQPPQTGPPRRSAGRGRLPRRGIVT
IVVGLVLALGLGVGIWYINSGQFTKMPYLLGKSEADARKKLKDAGLEVKITREFSDVVDK
GKVIKTDPGGGKQIRNTGTVTIHISDGPPRTQVPNVVGMPLKQARRQISDANLSVGEVTK
EFRDETPQGSVISTDPRAGTTRRPNTTVGIVVSRGPEIDIPDVVGESEDDARSDLEDAGF
KVKIAQERVFSDEDAGSVAEQSSSDGDTKGAKGDTITLTLSKGQEMIEVPDVTGMSEGDA
KQTLEAAGFEVDVDKPLLFPGDTVTDQSVDGGDEAPKGSSITIKFKGVF
Download sequence
Identical sequences D7CEU9
gi|374990607|ref|YP_004966102.1| WP_014180421.1.69245 WP_014180421.1.9551

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]